Product Type: Protein Name: Calprotectin, MRP-8/MRP-14, S100A8/A9 Accession ID: P05109, P06702, HS07074, HS08809 Source: Recombinant (E. coli), bacterial overexpression Molecular Weight: 23,945 Da Amino Acid Sequence: MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE/TCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP Purity: >95%, endotoxin-free Buffer: 20 mM Tris pH 8.0, 100 mM NaCl, 10 mM ?-mercaptoethanol Concentration: 8.3mg/mL (EVU202, EVU204); 12.2mg/mL (EVU201, EVU203) Comments: Quality control growth assays are performed on each batch of protein, ensuring that the protein is active Storage: -80C Shipped: Dry ice